PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0050s0135.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 253aa    MW: 28771.6 Da    PI: 8.6842
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0050s0135.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.6e-32958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  Cagra.0050s0135.1.p  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                         79**********************************************95 PP

2K-box100.62.2e-3375171399
                K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                           s g+++ e++++s++qe++kLk+++e+L r++R+llGedL+++ +keLq Le+qLe +l+  R++K+++++e++e+l+kke++l ++nk
  Cagra.0050s0135.1.p  75 CSLGNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINK 164
                          56677889999******************************************************************************* PP

                K-box  93 aLrkkle 99 
                          +L+ k+e
  Cagra.0050s0135.1.p 165 QLKIKFE 171
                          ***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.347161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.45E-43272No hitNo description
SuperFamilySSF554552.62E-33289IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-32323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-323859IPR002100Transcription factor, MADS-box
PfamPF014868.4E-3083170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.2586176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRGRVEMKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSL  60
GISRTIERYN RCYNCSLGNN KPEETTQSWC QEVTKLKSKY ESLVRTNRNL LGEDLGEMGV  120
KELQALERQL EAALTATRQR KTQVMMEEME DLRKKERQLG DINKQLKIKF ESEGYAFKTF  180
QELWANSGAT VGGVPNNSEF PVETSHPNSM DCNTEPFLQI GFQQHYYVQG EGSSVTKSNV  240
ASETNLVQGW VL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-20169169Myocyte-specific enhancer factor 2B
1tqe_R1e-20169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-20169169Myocyte-specific enhancer factor 2B
1tqe_P1e-20169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHAGL6A0.0M55554.1 Arabidopsis thaliana transcription factor (AGL6) mRNA, complete cds.
GenBankDQ4466240.0DQ446624.1 Arabidopsis thaliana clone pENTR221-At2g45650 MADS-box protein (At2g45650) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294857.10.0hypothetical protein CARUB_v10023910mg
SwissprotP293861e-179AGL6_ARATH; Agamous-like MADS-box protein AGL6
TrEMBLR0HR200.0R0HR20_9BRAS; Uncharacterized protein
STRINGAT2G45650.11e-176(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43022654
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-166AGAMOUS-like 6